Analytical Data
-
Gene name
KCNN4
- Application
-
Alternative Names
KCNN4；IK1；IKCA1；KCA4；Intermediate conductance calcium-activated potassium channel Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15554
-
Expression Region
328-427aa
-
AA Sequence
HTRRKESHAARRHQRKLLAAINAFRQVRLKHRKLREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLPEPSQQSK
-
Molecular Weight
47.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KCNN4, also known as the potassium calcium-activated channel subfamily N member 4, is a crucial ion channel that plays significant roles in various physiological processes, including smooth muscle contraction, neuronal signaling, and cardiac function. Recent studies have highlighted its importance in cellular excitability, where it regulates membrane potential and influences ion homeostasis. The understanding of KCNN4's structure and function has garnered interest due to its potential implications in diseases like hypertension, heart failure, and neurological disorders. Researchers have focused on the recombinant expression of KCNN4 to investigate its biophysical properties, pharmacological modulation, and physiological roles in detail. Such studies leverage advanced techniques in molecular biology and biochemistry to clone and express the KCNN4 gene, facilitating the characterization of the functional properties of the protein. Moreover, gaining insights into KCNN4's regulatory mechanisms could pave the way for the development of targeted therapies aimed at modulating its activity for clinical benefit. Overall, KCNN4 represents a promising target for further research, holding potential for innovative approaches in treating various ion channel-related pathologies.
