Cat: PA1000-4048

Recombinant Human TREML1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TREML1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TREML1;TLT1;Trem-like transcript 1 Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q86YW5

  • Expression Region

    16-162aa

  • AA Sequence

    QGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSS AVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQIL HRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIPVDH HHHHH

  • Molecular Weight

    17 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TREML1 (TREM-like 1) is a member of the TREM (Triggering Receptor Expressed on Myeloid Cells) family, which plays a significant role in the immune system by regulating inflammatory responses. It is primarily expressed in myeloid cells and has been implicated in various pathological conditions, including autoimmune diseases and infections. Recent studies have suggested that TREML1 may enhance the activity of immune cells, influencing their response to pathogens and modulating the severity of inflammatory diseases. The recombinant protein of TREML1 is generated to study its structural and functional properties, providing insights into its role in immune signaling pathways. Research focuses on understanding how TREML1 interacts with other cellular receptors and its influence on the activation and polarization of immune cells. Investigating TREML1 as a potential therapeutic target may open new avenues for treating inflammatory diseases and improving immune responses against infections. The study of TREML1 recombinant protein contributes to the broader understanding of the immune system's complexities and offers potential implications in the development of novel immune-modulating therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US