Analytical Data
-
Gene name
TREML1
- Application
-
Alternative Names
TREML1；TLT1；Trem-like transcript 1 Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86YW5
-
Expression Region
16-162aa
-
AA Sequence
QGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSS AVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQIL HRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIPVDH HHHHH
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TREML1 (TREM-like 1) is a member of the TREM (Triggering Receptor Expressed on Myeloid Cells) family, which plays a significant role in the immune system by regulating inflammatory responses. It is primarily expressed in myeloid cells and has been implicated in various pathological conditions, including autoimmune diseases and infections. Recent studies have suggested that TREML1 may enhance the activity of immune cells, influencing their response to pathogens and modulating the severity of inflammatory diseases. The recombinant protein of TREML1 is generated to study its structural and functional properties, providing insights into its role in immune signaling pathways. Research focuses on understanding how TREML1 interacts with other cellular receptors and its influence on the activation and polarization of immune cells. Investigating TREML1 as a potential therapeutic target may open new avenues for treating inflammatory diseases and improving immune responses against infections. The study of TREML1 recombinant protein contributes to the broader understanding of the immune system's complexities and offers potential implications in the development of novel immune-modulating therapies.
