Analytical Data
-
Gene name
ACKR3
- Application
-
Alternative Names
ACKR3；CMKOR1；CXCR7；GPR159；Atypical chemokine receptor 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P25106
-
Expression Region
1-362aa
-
AA Sequence
MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK
-
Molecular Weight
41.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ACKR3, also known as atypical chemokine receptor 3, is a member of the chemokine receptor family that has garnered significant attention due to its unique role in various physiological and pathological processes. Unlike traditional chemokine receptors that bind to ligands and elicit cellular responses, ACKR3 functions primarily as a scavenger receptor, modulating chemokine availability and activity in the microenvironment. This atypical behavior implicates ACKR3 in a range of biological functions such as immune response regulation, inflammation, and tumor progression. Its expression is notably upregulated in various cancers, linking ACKR3 to tumor growth, metastasis, and angiogenesis. Research into ACKR3 has expanded to explore its potential as a therapeutic target, especially in oncology, where its modulation could enhance anti-tumor immunity or inhibit tumor-promoting signals. Additionally, studies have demonstrated that ACKR3 interacts with various signaling pathways, further complicating our understanding of its role in cellular communication. Therefore, the development and characterization of recombinant ACKR3 proteins are crucial for elucidating its mechanism of action, validating potential therapeutic strategies, and facilitating the discovery of novel chemokine-based treatments.
