Analytical Data
-
Gene name
POPDC3
- Application
-
Alternative Names
POPDC3; POP3; Popeye domain-containing protein 3; Popeye protein 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HBV1
-
Expression Region
1-291 aa
-
AA Sequence
MERNSSLWKNLIDEHPVCTTWKQEAEGAIYHLASILFVVGFMGGSGFFGLLYVFSLLGLGFLCSAVWAWVDVCAADIFSWNFVLFVICFMQFVHIAYQVRSITFAREFQVLYSSLFQPLGISLPVFRTIALSSEVVTLEKEHCYAMQGKTSIDKLSLLVSGRIRVTVDGEFLHYIFPLQFLDSPEWDSLRPTEEGIFQVTLTAETDCRYVSWRRKKLYLLFAQHRYISRLFSVLIGSDIADKLYALNDRVYIGKRYHYDIRLPNFYQMSTPEIRRSPLTQHFQNSRRYCDK
-
Molecular Weight
60.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
POPDC3, a member of the Popeye domain containing protein family, has garnered significant attention in recent years due to its critical roles in various physiological processes, particularly in cardiac and skeletal muscle functions. Studies have indicated that POPDC3 is involved in regulating muscle contraction, signal transduction, and potentially influencing cellular responses to mechanical stress. Mutations in the POPDC3 gene have been linked to arrhythmogenic right ventricular cardiomyopathy (ARVC), a condition characterized by progressive heart muscle degeneration and increased risk of arrhythmias. The elucidation of POPDC3's structure and function is essential for understanding its mechanisms in muscle physiology and pathology. To further investigate its roles, researchers have been developing and characterizing recombinant POPDC3 proteins, which allow for in-depth biochemical and biophysical studies. These studies aim to reveal the protein's interaction with other cellular components and its impact on muscle cell signaling pathways. Moreover, understanding the molecular mechanisms underlying POPDC3-related diseases could pave the way for novel therapeutic strategies, making it a significant focus in cardiovascular research. The recombinant protein studies are not only instrumental in unraveling the functional aspects of POPDC3 but also serve as a foundation for potential applications in regenerative medicine and gene therapy targeting muscle-related disorders. Overall, the continued exploration of POPDC3 will shed light on its essential biological roles and could lead to advancements in treating heart diseases associated with its dysfunction.
