Cat: PA2000-1745

Recombinant Human TDGF1P3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TDGF1P3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TDGF1P3;CRIPTO-3;TDGF1P3;TDGF2;Putative Protein CRIPTO3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P51864

  • Expression Region

    31-188aa

  • AA Sequence

    LGHQEFARPSRGDLAFRDDSIWPQEEPAIRPRSSQRVLPMGIQHSKELNR TCCLNGGTCMLESFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSL CKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLAGI CLSIQSYY

  • Molecular Weight

    21.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TDGF1P3, also known as teratocarcinoma-derived growth factor 1 protein 3, is a novel protein that has garnered attention in the field of regenerative medicine and cancer biology. Its discovery stems from investigations into the molecular mechanisms underlying various developmental processes and tumorigenesis. Research indicates that TDGF1P3 may play a role in cell differentiation and tissue regeneration, particularly in embryonic stem cells and teratocarcinomas. The protein's expression patterns suggest it could be involved in signaling pathways that regulate cell growth and apoptosis, making it a potential candidate for therapeutic applications in cancer treatment and tissue engineering. Furthermore, studies have shown that TDGF1P3 interacts with other key cellular proteins, hinting at its functional importance in maintaining cellular homeostasis and responding to environmental stimuli. As such, uncovering the biological roles and regulatory mechanisms of TDGF1P3 could provide valuable insights into its potential as a biomarker for cancer prognosis and a target for novel therapeutic strategies. Continued research into this recombinant protein may lead to breakthroughs in understanding complex biological processes and developing innovative treatments for various diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US