Analytical Data
-
Gene name
DDI1
- Application
-
Alternative Names
DDI1;Protein DDI1 homolog 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WTU0
-
Expression Region
33-326aa
-
AA Sequence
LCEAESRVPVEEIQIIHMERLLIEDHCSLGSYGLKDGDIVVLLQKDNVGPRAPGRAPNQPRVDFSGIAVPGTSSSRPQHPGQQQQRTPAAQRSQGLASGEKVAGLQGLGSPALIRSMLLSNPHDLSLLKERNPPLAEALLSGSLETFSQVLMEQQREKALREQERLRLYTADPLDREAQAKIEEEIRQQNIEENMNIAIEEAPESFGQVTMLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGVAKGVGTQRIIGRVHLAQIQIEGDFLQCSFSILEDQPM
-
Molecular Weight
33 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DDI1 (DNA damage-inducible 1) is a ubiquitin-like protein implicated in critical cellular processes, including DNA repair, cell cycle regulation, and apoptosis. Its role in mediating responses to DNA damage has garnered significant interest, particularly in the context of cancer biology and therapeutic resistance. Recent studies have highlighted that DDI1 may influence the stability of specific proteins involved in the repair of DNA breaks, thus affecting cellular survival under genotoxic stress. Furthermore, the upregulation of DDI1 in various malignancies suggests a potential role in tumorigenesis and cancer progression. The characterization of DDI1 as a recombinant protein is essential for understanding its structural and functional properties, paving the way for potential applications in targeted cancer therapies. Research into the pathways regulated by DDI1 could unveil novel biomarkers for early cancer detection and novel targets for drug development. In this context, DDI1's ability to modulate key signaling pathways connected to the DNA damage response makes it a promising candidate for therapeutic intervention. The study of DDI1, especially its recombinant form, aims to provide a deeper understanding of its function and regulation, contributing to the broader field of cancer research and therapeutic innovation.











