Analytical Data
-
Gene name
ATXN7L4
- Application
-
Alternative Names
AT7L1_HUMAN; Ataxin 7 like 4; Ataxin 7 like Protein 1; ataxin 7-like 1; Ataxin-7-like Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9ULK2
-
Expression Region
1-146aa
-
AA Sequence
MTSERSRIPCLSAAAAEGTGKKQQEGRAMATLDRKVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKEDMHLFGHYPAHDDFYLVVCSACNQVVKPQVFQSHCGRKQDNRRNEGISRSGPESSQAIEKHQV
-
Molecular Weight
42.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ATXN7L4, a member of the Ataxin-7-like family, plays a significant role in various cellular processes, including transcription regulation and RNA processing. The gene encoding ATXN7L4 is thought to be involved in neurodegenerative diseases, particularly due to its homology with ATXN7, which is linked to spinocerebellar ataxia type 7 (SCA7). Research into ATXN7L4 has gained traction as scientists seek to understand its structure and function in both normal physiology and disease states. The production of recombinant ATXN7L4 protein allows for detailed investigation into its molecular mechanisms, interactions with other proteins, and potential implications in cellular signaling pathways. Techniques such as recombinant DNA technology facilitate the expression and purification of this protein, which is crucial for functional assays and structural studies. By elucidating the role of ATXN7L4, researchers aim to uncover its potential as a biomarker or therapeutic target in neurodegenerative conditions, contributing to the broader understanding of related pathologies and the development of targeted interventions. Overall, the study of ATXN7L4 serves as an important avenue for exploring the complexities of gene function and its impact on human health.
