Analytical Data
-
Gene name
ATP8B4
- Application
-
Alternative Names
ATP8B4; KIAA1939Probable phospholipid-transporting ATPase IM; EC 7.6.2.1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TF62
-
Expression Region
401-488aa
-
AA Sequence
IMTFKRCSINGRIYGEVHDDLDQKTEITQEKEPVDFSVKSQADREFQFFDHHLMESIKMGDPKVHEFLRLLALCHTVMSEENSAGELI
-
Molecular Weight
35.42 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ATP8B4, a member of the aminophospholipid transporter family, plays a crucial role in maintaining lipid homeostasis and membrane integrity in cells. Mutations in the ATP8B4 gene have been associated with progressive familial intrahepatic cholestasis type 1 (PFIC1), a severe liver disease characterized by cholestasis and progressive liver failure. Understanding the function and mechanisms of ATP8B4 is vital for elucidating the pathogenesis of PFIC1 and exploring potential therapeutic strategies. Recent studies have focused on the characterization of recombinant ATP8B4 proteins to investigate their transport properties, stability, and interactions with lipids and other cellular components. By utilizing advanced techniques such as cryo-electron microscopy and lipidomics, researchers aim to decipher the structural and functional aspects of ATP8B4, providing insights into how its dysfunction leads to liver pathology. This research not only enhances our understanding of ATP8B4's biological significance but also holds promise for developing targeted interventions for patients affected by related liver disorders.
