Analytical Data
-
Gene name
WIBG
- Application
-
Alternative Names
WIBG；PYM；Partner of Y14 and mago
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BRP8
-
Expression Region
1-204aa
-
AA Sequence
MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYV KFFKSKPELPPGLSP EATAPVTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDK VSLEETAQLPSAPQG SRAAPTAASDQPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPS KEQLEKLARRRALEE ELEDLELGLLEHHHHHH
-
Molecular Weight
24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
WIBG (Wnt inhibitory factor 1) is a protein that has garnered significant attention in recent years due to its role in various biological processes, including tissue development, cellular differentiation, and cancer progression. Research indicates that WIBG functions as a critical regulator of the Wnt signaling pathway, which is vital for embryonic development and stem cell maintenance. Aberrant activation of this pathway has been implicated in several cancers, making WIBG a potential target for therapeutic interventions. Studies have shown that the modulation of WIBG expression can influence cell proliferation and apoptosis, thus highlighting its importance in cancer biology. Furthermore, the structural characterization of WIBG and its interactions with other proteins can provide insights into its functional mechanisms and potential applications in biomedical research. The recombinant production of WIBG allows for detailed studies on its biochemical properties and therapeutic potential, paving the way for innovative strategies in cancer treatment and regenerative medicine. As research progresses, understanding the nuances of WIBG's function and regulation may unlock new avenues for targeted therapies that leverage its unique properties, contributing to the development of more effective, personalized medical treatments.
