Cat: PA1000-3485

Recombinant Human WIBG Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    WIBG

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    WIBG;PYM;Partner of Y14 and mago

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BRP8

  • Expression Region

    1-204aa

  • AA Sequence

    MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYV KFFKSKPELPPGLSP EATAPVTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDK VSLEETAQLPSAPQG SRAAPTAASDQPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPS KEQLEKLARRRALEE ELEDLELGLLEHHHHHH

  • Molecular Weight

    24 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

WIBG (Wnt inhibitory factor 1) is a protein that has garnered significant attention in recent years due to its role in various biological processes, including tissue development, cellular differentiation, and cancer progression. Research indicates that WIBG functions as a critical regulator of the Wnt signaling pathway, which is vital for embryonic development and stem cell maintenance. Aberrant activation of this pathway has been implicated in several cancers, making WIBG a potential target for therapeutic interventions. Studies have shown that the modulation of WIBG expression can influence cell proliferation and apoptosis, thus highlighting its importance in cancer biology. Furthermore, the structural characterization of WIBG and its interactions with other proteins can provide insights into its functional mechanisms and potential applications in biomedical research. The recombinant production of WIBG allows for detailed studies on its biochemical properties and therapeutic potential, paving the way for innovative strategies in cancer treatment and regenerative medicine. As research progresses, understanding the nuances of WIBG's function and regulation may unlock new avenues for targeted therapies that leverage its unique properties, contributing to the development of more effective, personalized medical treatments.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US