Cat: PA2000-1613

Recombinant Human ISM1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ISM1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ISM1;C20orf82;ISM;Isthmin-1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    B1AKI9

  • Expression Region

    30-464aa

  • AA Sequence

    ADGPDAAAGNASQAQLQNNLNVGSDTTSETSFSLSKEAPREHLDHQAAHQ PFPRPRFRQETGHPSLQRDFPRSFLLDLPNFPDLSKADINGQNPNIQVTI EVVDGPDSEADKDQHPENKPSWSVPSPDWRAWWQRSLSLARANSGDQDYK YDSTSDDSNFLNPPRGWDHTAPGHRTFETKDQPEYDSTDGEGDWSLWSVC SVTCGNGNQKRTRSCGYACTATESRTCDRPNCPGIEDTFRTAATEVSLLA GSEEFNATKLFEVDTDSCERWMSCKSEFLKKYMHKVMNDLPSCPCSYPTE VAYSTADIFDRIKRKDFRWKDASGPKEKLEIYKPTARYCIRSMLSLESTT LAAQHCCYGDNMQLITRGKGAGTPNLISTEFSAELHYKVDVLPWIICKGD WSRYNEARPPNNGQKCTESPSDEDYIKQFQEAREY

  • Molecular Weight

    69 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ISM1 is a member of the imprinted gene family, primarily expressed in the mammalian testis and plays a pivotal role in reproductive biology. Its research background is rooted in the understanding of genomic imprinting, a genetic phenomenon where certain genes are expressed in a parent-of-origin-specific manner. Imprinted genes like ISM1 are crucial for regulating growth and development in mammals. Recent studies have highlighted ISM1's potential involvement in male fertility and spermatogenesis, as its expression is linked to sperm quality and function. Furthermore, alterations in the expression of ISM1 have been implicated in various reproductive disorders and developmental abnormalities, making it an essential candidate for studying the molecular mechanisms underlying these conditions. The advent of recombinant protein technology has enabled researchers to produce ISM1 in a laboratory setting, facilitating the investigation of its structural and functional properties. By characterizing ISM1's protein interactions and biological activity, scientists aim to uncover its roles in spermatogenic processes and its implications in reproductive health. This research not only enhances the understanding of the genetic factors contributing to male infertility but also opens avenues for potential therapeutic interventions in managing reproductive challenges related to imprinted gene dysregulation. Overall, the study of recombinant ISM1 protein is poised to provide critical insights into the complex interplay between genetics and reproduction, positioning it as a significant focus in the fields of reproductive biology and molecular genetics.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US