Analytical Data
-
Gene name
PROK
- Application
-
Alternative Names
PROK；BV8；Prokineticin-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P58294
-
Expression Region
1-105aa
-
AA Sequence
MRGATRVSIMLLLVTVSDCAVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF
-
Molecular Weight
11.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PROK, or prokineticin, is a family of proteins that play significant roles in various biological processes, including angiogenesis, circadian rhythms, and reproductive functions. Research into PROK recombinant proteins has gained momentum due to their involvement in critical signaling pathways. Specifically, PROK2, one of the two known isoforms, has emerged as a key player in neurobiology and endocrinology. It interacts with specific receptors, influencing neuronal activities and hormonal regulation. Additionally, PROK proteins are linked to various pathological conditions, including cancer, where their expression patterns may provide insights into tumor progression and metastasis. Understanding the structure and function of recombinant PROK proteins can open up new avenues for therapeutic interventions, especially in targeting diseases associated with their dysregulation. Furthermore, the advancement of recombinant DNA technology facilitates the production of these proteins in a controlled manner, allowing for detailed studies of their biological functions and potential applications in medicine. Overall, the investigation of PROK recombinant proteins is a promising area of research with implications for understanding complex physiological processes and developing novel therapeutic strategies.
