Analytical Data
-
Gene name
ATP5G1
- Application
-
Alternative Names
ATP5MC1; ATP5G1; ATP synthase F(0 complex subunit C1. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P05496
-
Expression Region
18-136aa
-
AA Sequence
TRGLIRPVSASFLSSPVNSSKQPSYSNFPLQVARREFQTSVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
-
Molecular Weight
38.83 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ATP5G1, a crucial subunit of the ATP synthase complex, plays a vital role in ATP production via oxidative phosphorylation in mitochondria. As a member of the ATPase family, ATP5G1 is involved in the synthesis of adenosine triphosphate (ATP), the primary energy carrier in cells. Research has shown that dysregulation of ATP5G1 and related mitochondrial functions can be linked to various diseases, including cancer and neurodegenerative disorders. Scientists have increasingly recognized the importance of studying ATP5G1 to understand its potential as a therapeutic target. The recombinant expression of ATP5G1 allows for detailed biochemical and structural analyses, facilitating the exploration of its functional mechanisms and interaction with other mitochondrial proteins. This research is crucial for developing novel strategies to modulate ATP production and address mitochondrial dysfunction-related diseases. By generating and characterizing ATP5G1 recombinant proteins, researchers aim to uncover insights into its role in cellular metabolism, establish its involvement in disease mechanisms, and potentially provide a foundation for therapeutic interventions.
