Cat: PA2000-5687

Recombinant Human ATP5G1 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ATP5G1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ATP5MC1; ATP5G1; ATP synthase F(0 complex subunit C1. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P05496

  • Expression Region

    18-136aa

  • AA Sequence

    TRGLIRPVSASFLSSPVNSSKQPSYSNFPLQVARREFQTSVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM

  • Molecular Weight

    38.83 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ATP5G1, a crucial subunit of the ATP synthase complex, plays a vital role in ATP production via oxidative phosphorylation in mitochondria. As a member of the ATPase family, ATP5G1 is involved in the synthesis of adenosine triphosphate (ATP), the primary energy carrier in cells. Research has shown that dysregulation of ATP5G1 and related mitochondrial functions can be linked to various diseases, including cancer and neurodegenerative disorders. Scientists have increasingly recognized the importance of studying ATP5G1 to understand its potential as a therapeutic target. The recombinant expression of ATP5G1 allows for detailed biochemical and structural analyses, facilitating the exploration of its functional mechanisms and interaction with other mitochondrial proteins. This research is crucial for developing novel strategies to modulate ATP production and address mitochondrial dysfunction-related diseases. By generating and characterizing ATP5G1 recombinant proteins, researchers aim to uncover insights into its role in cellular metabolism, establish its involvement in disease mechanisms, and potentially provide a foundation for therapeutic interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US