Analytical Data
-
Gene name
PEX13
- Application
-
Alternative Names
2610008O20Rik; NALD; OTTMUSP00000005454; Peroxin 13; Peroxin-13; Peroxin13; Peroxisomal membrane protein PEX 13; Peroxisomal membrane protein PEX13; Peroxisome biogenesis factor 13; PEX 13; pex13; PEX13_HUMAN; RP23-188K3.1; ZWS
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92968
-
Expression Region
1-403 aa
-
AA Sequence
MASQPPPPPKPWETRRIPGAGPGPGPGPTFQSADLGPTLMTRPGQPALTRVPPPILPRPSQQTGSSSVNTFRPAYSSFSSGYGAYGNSFYGGYSPYSYGYNGLGYNRLRVDDLPPSRFVQQAEESSRGAFQSIESIVHAFASVSMMMDATFSAVYNSFRAVLDVANHFSRLKIHFTKVFSAFALVRTIRYLYRRLQRMLGLRRGSENEDLWAESEGTVACLGAEDRAATSAKSWPIFLFFAVILGGPYLIWKLLSTHSDEVTDSINWASGEDDHVVARAEYDFAAVSEEEISFRAGDMLNLALKEQQPKVRGWLLASLDGQTTGLIPANYVKILGKRKGRKTVESSKVSKQQQSFTNPTLTKGATVADSLDEQEAAFESVFVETNKVPVAPDSIGKDGEKQDL
-
Molecular Weight
70.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PEX13 is a crucial component of the peroxisomal biogenesis machinery, playing an essential role in the formation and maintenance of peroxisomes, which are vital organelles involved in lipid metabolism and reactive oxygen species detoxification. Mutations or dysfunctions in PEX13 have been associated with peroxisomal biogenesis disorders (PBDs), leading to severe metabolic abnormalities and developmental issues. Research on PEX13 recombinant proteins has gained traction in recent years, as understanding its structure, function, and interactions with other peroxins can provide insights into the pathogenesis of PBDs. With advances in recombinant DNA technology and protein expression systems, scientists can produce large quantities of PEX13, enabling detailed biochemical and biophysical studies. These investigations aim to decipher the molecular mechanisms underlying PEX13's role in peroxisome assembly, including its interactions with other peroxisomal membrane proteins and its role in protein import processes. Additionally, characterizing PEX13 may pave the way for potential therapeutic interventions for PBDs, offering hope for patients affected by these debilitating disorders. In summary, the study of recombinant PEX13 proteins is vital for unraveling the complexities of peroxisome biology and developing strategies to mitigate the effects of related genetic disorders.
