Analytical Data
-
Gene name
PEX12
- Application
-
Alternative Names
PEX12; PAF3; Peroxisome assembly protein 12; Peroxin-12; Peroxisome assembly factor 3; PAF-3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00623
-
Expression Region
1-359 aa
-
AA Sequence
MAEHGAHFTAASVADDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPTHYGFLWRWFDEIFTLLDLLLQQHYLSRTSASFSENFYGLKRIVMGDTHKSQRLASAGLPKQQLWKSIMFLVLLPYLKVKLEKLVSSLREEDEYSIHPPSSRWKRFYRAFLAAYPFVNMAWEGWFLVQQLRYILGKAQHHSPLLRLAGVQLGRLTVQDIQALEHKPAKASMMQQPARSVSEKINSALKKAVGGVALSLSTGLSVGVFFLQFLDWWYSSENQETIKSLTALPTPPPPVHLDYNSDSPLLPKMKTVCPLCRKTRVNDTVLATSGYVFCYRCVFHYVRSHQACPITGYPTEVQHLIKLYSPEN
-
Molecular Weight
65.23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PEX12, a member of the PEX family of proteins, plays a critical role in peroxisome biogenesis and function. Peroxisomes are essential organelles involved in various metabolic processes, including the degradation of fatty acids and the detoxification of reactive oxygen species. Mutations in PEX12 have been linked to Zellweger syndrome and other peroxisome biogenesis disorders, leading to severe developmental issues and metabolic dysfunctions. Understanding the structure and function of PEX12 is vital for elucidating the mechanisms underlying peroxisome assembly and the pathological consequences of its dysfunction. Recent studies have focused on the recombinant expression and characterization of PEX12 to explore its interactions with other peroxins and its role in the import of peroxisomal matrix proteins. Advanced techniques such as X-ray crystallography and cryo-electron microscopy are being employed to provide insights into the protein’s three-dimensional structure and its functional domains. Additionally, insights gained from PEX12 research may pave the way for potential therapeutic strategies aimed at ameliorating the effects of peroxisomal disorders, highlighting its significance in both basic and translational research.
