Analytical Data
-
Gene name
ATP5G2
- Application
-
Alternative Names
Atp5mc2; Atp5g2; ATP synthase F(0 complex subunit C2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q06055
-
Expression Region
1-141aa
-
AA Sequence
MFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
-
Molecular Weight
41.25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ATP5G2, a gene encoding a subunit of the ATP synthase complex, plays a crucial role in ATP production within mitochondria. This protein is part of the F0F1-ATP synthase complex, essential for cellular energy metabolism. Research has shown that ATP5G2 is involved in various biological processes, including cellular respiration and the regulation of apoptosis. Dysregulation of ATP5G2 expression has been linked to several diseases, including cancer and neurodegenerative disorders, highlighting its potential as a biomarker for disease progression and a target for therapeutic interventions. Additionally, the study of ATP5G2 recombinant protein provides insights into its biochemical properties and interactions with other mitochondrial components, facilitating a deeper understanding of mitochondrial function and energy homeostasis. Researchers are increasingly focused on characterizing the dynamics of ATP5G2 under different physiological conditions, as well as exploring its role in cellular stress responses. The development of recombinant ATP5G2 protein enables functional studies that may uncover the mechanistic pathways through which this protein influences mitochondrial activity and overall cellular health, which could have significant implications for understanding metabolic disorders and developing new treatment strategies.
