Analytical Data
-
Gene name
ATP5E
- Application
-
Alternative Names
ATP5F1E; ATP5EATP synthase subunit epsilon; mitochondrial; ATPase subunit epsilon
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P56381
-
Expression Region
1-51aa
-
AA Sequence
MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE
-
Molecular Weight
31.35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ATP5E, a nuclear-encoded gene, plays a crucial role in mitochondrial ATP synthesis by encoding a subunit of ATP synthase, which is the enzyme responsible for producing adenosine triphosphate (ATP) during oxidative phosphorylation. Research into ATP5E has gained significant attention due to its potential implications in various metabolic disorders and mitochondrial dysfunctions. Dysregulation or mutations in the ATP5E gene can lead to impaired ATP production, resulting in energy deficiencies that affect cellular functions and overall health. Understanding the structure and function of ATP5E is essential for elucidating the mechanisms of energy metabolism and the pathogenesis of related diseases, such as neurodegenerative disorders, cardiovascular diseases, and metabolic syndromes. Furthermore, the ability to produce recombinant ATP5E protein has facilitated experimental studies, allowing researchers to investigate its biochemical properties, interactions with other mitochondrial components, and its role in ATP synthase assembly and function. This research is pivotal for developing potential therapeutic strategies to combat conditions associated with mitochondrial dysregulation and for exploring the broader implications of ATP synthesis in human health.
