Cat: PA1000-3423

Recombinant Human UQCRC2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    UQCRC2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    UQCRC2;Cytochrome b-c1 complex subunit 2. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P22695

  • Expression Region

    15-453aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMSLKVAPKVKATAAPAGAPPQPQDLEFTKL PNGLVIASLENYSPVSRIGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKG ASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTA PEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCP DYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGG LGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVL GAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQ ATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFL EEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGN LGHTPFVDEL

  • Molecular Weight

    49 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

UQCRC2, or Ubiquinol-cytochrome c reductase core protein 2, is a critical component of the mitochondrial respiratory chain, specifically part of complex III, which plays an essential role in cellular energy production through oxidative phosphorylation. The protein facilitates the transfer of electrons from ubiquinol to cytochrome c, thereby contributing to the proton gradient necessary for ATP synthesis. Dysregulation of UQCRC2 has been implicated in various mitochondrial disorders and has been associated with neurodegenerative diseases, highlighting its importance in maintaining mitochondrial function and cellular homeostasis. Researchers have increasingly focused on studying UQCRC2’s structure, function, and interactions to elucidate its role in mitochondrial biology and pathology. Understanding the protein's activity could provide insights into therapeutic targets for diseases linked to mitochondrial dysfunction. Recent advances in biotechnology, such as recombinant protein expression and purification methods, have enabled detailed studies of UQCRC2, revealing its mechanistic roles and regulatory mechanisms within the electron transport chain. As a result, UQCRC2 research is poised to enhance our comprehension of energy metabolism and its implications in health and disease, paving the way for potential clinical applications in mitochondrial-related therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US