Analytical Data
-
Gene name
PG
- Application
-
Alternative Names
PG；SLRR1B；Decorin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P07585
-
Expression Region
20-359aa
-
AA Sequence
QQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK
-
Molecular Weight
41.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PhcU glycosyltransferases (PGT) are significant enzymes that play crucial roles in the biosynthesis of polysaccharides and glycoconjugates across various organisms, including bacteria, archaea, and eukaryotes. The study of PGTs is vital due to their implications in understanding cellular processes, including cell-cell communication, immune responses, and pathogen-host interactions. PGTs contribute to the modification and diversification of glycan structures, which are essential for bacterial virulence and immune evasion. Recent advancements in genomic and biochemical techniques have enabled researchers to explore the functional diversity and structural characteristics of PGTs, leading to insights into their mechanisms of action. Additionally, the potential for PGTs in biotechnological applications, such as the development of targeted therapeutics and vaccines, has underscored the importance of this field. By elucidating the structure-function relationships of PGTs, scientists aim to harness their unique properties for innovative applications in medicine and industry, ultimately contributing to the advancement of glycoengineering and the development of novel therapies for various diseases.
