Analytical Data
-
Gene name
ATAD4
- Application
-
Alternative Names
PRR15L; ATAD4; Proline-rich Protein 15-like Protein; Protein ATAD4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BU68
-
Expression Region
1-103aa
-
AA Sequence
MTTEIGWWKLTFLRKKKSTPKVLYEIPDTYAQTEGDAEPPRPDAGGPNSDFNTRLEKIVDKSTKGKHVKVSNSGRFKEKKKVRATLAENPNLFDDHEEGRSSK
-
Molecular Weight
38.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ATAD4, a member of the ATPase family of proteins, plays a crucial role in the regulation of cellular processes, including gene expression and protein quality control. It is known to be involved in the assembly and disassembly of protein complexes, particularly in the context of chromatin remodeling and DNA repair. Recent studies have revealed that ATAD4 is implicated in various biological processes such as cell proliferation, differentiation, and stress response, highlighting its potential significance in cancer biology and other diseases. The interest in ATAD4 as a therapeutic target has been growing due to its overexpression in several types of cancer, suggesting that it may contribute to tumorigenesis by modulating transcriptional programs and cellular homeostasis. Furthermore, the elucidation of its structural and functional characteristics through recombinant protein studies can provide insights into its mechanism of action and interactions with other cellular components. Understanding the function and regulatory mechanisms of ATAD4 is therefore essential for uncovering its role in health and disease, paving the way for novel diagnostic and therapeutic strategies. Current research efforts are focused on characterizing ATAD4 through recombinant expression systems, allowing for the study of its biophysical properties, enzymatic activities, and interaction with potential binding partners, thus contributing to a more comprehensive understanding of its biological significance.
