Cat: PAX2000-10227

Recombinant Human PDZK1IP1 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PDZK1IP1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PDZK1IP1; MAP17; PDZK1-interacting protein 1; 17 kDa membrane-associated protein; Protein DD96

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q13113

  • Expression Region

    1-114 aa

  • AA Sequence

    MSALSLLILGLLTAVPPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAVNHFWCQEEPEPAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRSTPM

  • Molecular Weight

    38.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PDZK1IP1, also known as PDZK1 interacting protein 1, is a member of the PDZ domain-containing protein family, which plays crucial roles in various cellular processes, including signal transduction, cell adhesion, and cytoskeletal organization. The protein is predominantly expressed in the kidney and is implicated in the regulation of ion channels and transporters, particularly in relation to sodium and potassium homeostasis. Dysregulation of PDZK1IP1 has been associated with various pathological conditions, such as hypertension and renal diseases, making it a potential therapeutic target. Recent studies have focused on the structural and functional characterization of PDZK1IP1, utilizing recombinant protein techniques to elucidate its binding interactions and signaling pathways. By producing recombinant PDZK1IP1, researchers aim to better understand its role in cellular mechanisms at the molecular level, create specific inhibitors or modulators, and explore its potential as a biomarker in disease settings. As such, PDZK1IP1 represents a significant focus of research in the field of molecular biology, with its study shedding light on the intricate regulatory networks that govern kidney function and overall physiological homeostasis.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US