Analytical Data
-
Gene name
PDZK1IP1
- Application
-
Alternative Names
PDZK1IP1; MAP17; PDZK1-interacting protein 1; 17 kDa membrane-associated protein; Protein DD96
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13113
-
Expression Region
1-114 aa
-
AA Sequence
MSALSLLILGLLTAVPPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAVNHFWCQEEPEPAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRSTPM
-
Molecular Weight
38.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PDZK1IP1, also known as PDZK1 interacting protein 1, is a member of the PDZ domain-containing protein family, which plays crucial roles in various cellular processes, including signal transduction, cell adhesion, and cytoskeletal organization. The protein is predominantly expressed in the kidney and is implicated in the regulation of ion channels and transporters, particularly in relation to sodium and potassium homeostasis. Dysregulation of PDZK1IP1 has been associated with various pathological conditions, such as hypertension and renal diseases, making it a potential therapeutic target. Recent studies have focused on the structural and functional characterization of PDZK1IP1, utilizing recombinant protein techniques to elucidate its binding interactions and signaling pathways. By producing recombinant PDZK1IP1, researchers aim to better understand its role in cellular mechanisms at the molecular level, create specific inhibitors or modulators, and explore its potential as a biomarker in disease settings. As such, PDZK1IP1 represents a significant focus of research in the field of molecular biology, with its study shedding light on the intricate regulatory networks that govern kidney function and overall physiological homeostasis.
