Analytical Data
-
Gene name
PIK3Ca
- Application
-
Alternative Names
PIK3Ca；Phosphatidylinositol 4.5-bisphosphate 3-kinase catalytic subunit alpha isoform
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P42336
-
Expression Region
797-1068aa
-
AA Sequence
NEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
-
Molecular Weight
33.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The PIK3CA gene encodes the p110α catalytic subunit of the phosphoinositide 3-kinase (PI3K) enzyme, which plays a vital role in cellular processes such as growth, proliferation, and survival by mediating signaling pathways activated by various growth factors. Mutations in PIK3CA are frequently observed in various cancers, including breast, colon, and endometrial cancers, making it a significant target for therapeutic intervention. Research into PIK3CA recombinant proteins has gained momentum as these proteins can be utilized to better understand the functional implications of specific mutations and their contributions to oncogenic signaling pathways. By producing and characterizing these recombinant proteins, researchers aim to elucidate the mechanisms underlying PI3K-mediated cellular transformation and devise novel inhibitors that can selectively target aberrant PI3K activity in cancer cells. Furthermore, PIK3CA recombinant proteins can serve as valuable tools for drug discovery, enabling high-throughput screening of potential therapeutics and providing insights into resistance mechanisms. Overall, the study of PIK3CA recombinant proteins is essential for advancing our understanding of cancer biology and developing effective targeted therapies.
