Cat: PA1000-3409

Recombinant Human UGT1A1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    UGT1A1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    UGT1A1;GNT1;UDP-glucuronosyltransferase 1A1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P22309

  • Expression Region

    25-490aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSHAGKILLIPVDGSHWLSMLGAIQQLQQ RGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQREDVKESFVSLGHNVFEN DSFLQRVIKTYKKIKKDSAMLLSGCSHLLHNKELMASLAESSFDVMLTDP FLPCSPIVAQYLSLPTVFFLHALPCSLEFEATQCPNPFSYVPRPLSSHSD HMTFLQRVKNMLIAFSQNFLCDVVYSPYATLASEFLQREVTVQDLLSSAS VWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEHGI VVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILV KWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAK RMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHKDRPV EPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLD

  • Molecular Weight

    55 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

UGT1A1 (UDP-glucuronosyltransferase 1A1) is an important enzyme in the human liver, primarily responsible for the glucuronidation process, which facilitates the metabolism and excretion of a wide variety of endogenous and exogenous substances, including bilirubin, hormones, and drugs. Mutations and polymorphisms in the UGT1A1 gene can lead to impaired enzyme activity, resulting in conditions such as Gilbert's syndrome and Crigler-Najjar syndrome, which are characterized by elevated bilirubin levels and potential liver damage. Due to its crucial role in drug metabolism, UGT1A1 also significantly influences pharmacokinetics and pharmacodynamics, affecting drug efficacy and toxicity. Therefore, the study of UGT1A1 recombinant protein is vital for understanding its functional mechanisms, potential drug interactions, and genetic variability in populations. The production of UGT1A1 as a recombinant protein allows for detailed biochemical studies, enabling researchers to analyze its structure, substrate specificity, and the effects of various inhibitors or inducers. Such research is not only essential for elucidating the enzyme's role in metabolism but also holds promise for developing personalized medicine approaches, optimizing drug therapy, and improving patient outcomes. As drug regimens are increasingly tailored to individual genetic profiles, understanding UGT1A1's function through recombinant protein studies provides a foundation for advancing pharmacogenomics and enhances our ability to predict responses to therapeutic agents based on genetic variations.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US