Cat: PA1000-3408

Recombinant Human UGP2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    UGP2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    UGP2;UGP1;UTP--glucose-1-phosphate uridylyltransferase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q16851

  • Expression Region

    1-508aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMSRFVQDLSKAMSQDGASQFQEVIRQE LELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGK IQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPK SLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQK YNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIY ASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCE FVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIF NTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIK SFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTV PLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVI IIANHGDRIDIPPGAVLENKIVSGNLRILDH

  • Molecular Weight

    59 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

UGP2 (Uridine Diphosphate Glucose Pyrophosphorylase 2) is an enzyme that plays a crucial role in carbohydrate metabolism by catalyzing the conversion of glucose-1-phosphate and uridine triphosphate (UTP) into uridine diphosphate glucose (UDP-glucose) and pyrophosphate. This reaction is fundamental for synthesizing glycosylated compounds, which are essential for various biological processes, including energy storage, cell signaling, and the synthesis of complex carbohydrates. Research into UGP2 has gained attention due to its potential implications in various fields, including plant biology, as this enzyme is vital for plant growth and development through its involvement in starch biosynthesis and cell wall formation. Moreover, UGP2 is implicated in metabolic disorders and diseases, making it a target for therapeutic interventions. Understanding the structure, function, and regulation of UGP2 is critical for elucidating its role in metabolic pathways and developing strategies to manipulate its activity for agricultural or medical applications. Advances in recombinant DNA technology have enabled the production of UGP2 as a recombinant protein, facilitating in-depth studies of its biochemical properties and interactions. This has opened new avenues for exploring the enzyme's potential as a biotechnological tool in bioprocesses and its applications in improving crop yields and understanding human health conditions associated with carbohydrate metabolism.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US