Cat: PA1000-3407

Recombinant Human UgDH Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    UgDH

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    UgDH;UDP-glucose 6-dehydrogenase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O60701

  • Expression Region

    1-494aa

  • AA Sequence

    MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSELEMFEIKKICCIG AGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEVV ESCRGKNLFFSTNIDDAIKEADLVFISVNTPTKTYGMGKGRAADLKYIEA CARRIVQNSNGYKIVTEKSTVPVRAAESIRRIFDANTKPNLNLQVLSNPE FLAEGTAIKDLKNPDRVLIGGDETPEGQRAVQALCAVYEHWVPREKILTT NTWSSELSKLAANAFLAQRISSINSISALCEATGADVEEVATAIGMDQRI GNKFLKASVGFGGSCFQKDVLNLVYLCEALNLPEVARYWQQVIDMNDYQR RRFASRIIDSLFNTVTDKKIAILGFAFKKDTGDTRESSSIYISKYLMDEG AHLHIYDPKVPREQIVVDLSHPGVSEDDQVSRLVTISKDPYEACDGAHAV VICTEWDMFKELDYERIHKKMLKPAFIFDGRRVLDGLHNELQTIGFQIET IGKKVSSKRIPYAPSGEIPKFSLQDPPNKKPKV

  • Molecular Weight

    60 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

UgDH, or Uroporphyrinogen Decarboxylase, is a critical enzyme in the heme biosynthesis pathway, catalyzing the decarboxylation of uroporphyrinogen to coproporphyrinogen. This enzyme plays a crucial role in the production of heme, an essential component for various biological processes, including oxygen transport and cellular respiration. Deficiencies or mutations in UgDH can lead to congenital erythropoietic porphyria, a rare genetic disorder characterized by an accumulation of porphyrins and associated with serious health issues such as photosensitivity and hemolytic anemia. Research on recombinant UgDH has gained momentum owing to its potential applications in therapeutic strategies and industrial biotechnology. By producing and characterizing the recombinant form of UgDH, scientists aim to better understand its structure-function relationships, regulatory mechanisms, and interaction with substrates. Furthermore, recombinant UgDH can be utilized for enzyme replacement therapies in affected individuals and in the development of biosensors for porphyrin detection. The exploration of UgDH not only contributes to our understanding of porphyrin metabolism but also opens avenues for innovative approaches in treating related disorders and harnessing the enzyme's properties for biotechnological advancements. Overall, the study of UgDH is essential for unraveling the complexities of heme biosynthesis and its implications in human health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US