Analytical Data
-
Gene name
PDS5A
- Application
-
Alternative Names
Cell proliferation inducing protein 54 ; Cell proliferation-inducing gene 54 protein; KIAA0648; PDS5; regulator of cohesion maintenance; homolog A (S. cerevisiae); PDS5A; PDS5A_HUMAN; PIG54; SCC-112; SCC112; Sister chromatid cohesion protein 112; Sister chromatid cohesion protein PDS5 homolog A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q29RF7
-
Expression Region
1-333 aa
-
AA Sequence
MIHLLAHDPDFTRSQDVDQLRDIKECLWFMLEVLMTKNENNSHAFMKKMAENIKLTRDAQSPDESKTNEKLYTVCDVALCVINSKSALCNADSPKDPVLPMKFFTQPEKDFCNDKSYISEETRVLLLTGKPKPAGVLGAVNKPLSATGRKPYVRSTGTETGSNINVNSELNPSTGNRSREQSSEAAETGVSENEENPVRIISVTPVKNIDPVKNKEINSDQATQGNISSDRGKKRTVTAAGAENIQQKTDEKVDESGPPAPSKPRRGRRPKSESQGNATKNDDLNKPINKGRKRAAVGQESPGGLEAGNAKAPKLQDLAKKAAPAERQIDLQR
-
Molecular Weight
62.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PDS5A is a protein that plays a critical role in the proper maintenance of genome integrity and the regulation of cell division. It is a member of the PDS5 family, which is known to interact with the cohesin complex, a multi-subunit protein complex essential for sister chromatid cohesion during mitosis and meiosis. The regulation of cohesin is crucial for accurate chromosome segregation; thus, PDS5A is believed to be involved in the prevention of aneuploidy and other chromosomal aberrations that can lead to various diseases, including cancer. Recent studies have highlighted PDS5A's functions beyond just cohesin regulation, suggesting potential roles in DNA damage response, chromatin remodeling, and transcriptional regulation. Understanding PDS5A's mechanisms of action could provide valuable insights into its contributions to cellular processes and its implications in cancer biology and therapy. Given its significant role in cell cycle control and genomic stability, PDS5A has garnered attention as a potential biomarker or therapeutic target in cancer treatment strategies, making it an important focus of ongoing research in molecular and cellular biology.
