Analytical Data
-
Gene name
UCHL3
- Application
-
Alternative Names
UCHL3；Ubiquitin carboxyl-terminal hydrolase isozyme L3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P15374
-
Expression Region
1- 230aa
-
AA Sequence
MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC AVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGL IHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHET SAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDET LLEDAIEVCKKFMERDPDELRFNAIALSAA
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UCHL3 (Ubiquitin C-terminal hydrolase L3) is a member of the ubiquitin-specific protease family, which plays a crucial role in the ubiquitin-proteasome system responsible for protein degradation and regulation. Recent studies have highlighted UCHL3's involvement in various cellular processes, including protein homeostasis, cell cycle regulation, and stress response, making it a significant player in both normal physiology and disease states. Its potential links to neurodegenerative diseases, such as Alzheimer’s and Parkinson’s, where ubiquitin-dependent pathways are often disrupted, have spurred interest in its functional mechanisms. Additionally, UCHL3 has been shown to regulate the stability and activity of key signaling proteins, thereby influencing cellular signaling pathways. The development and characterization of recombinant UCHL3 protein are essential for elucidating its biochemical properties and understanding its interaction with various substrates. By generating a reliable source of recombinant UCHL3, researchers aim to facilitate in vitro studies that can unveil its role in cellular homeostasis and pathology, paving the way for novel therapeutic strategies targeting UCHL3 in various diseases. The ongoing research into UCHL3 not only enhances our comprehension of ubiquitin-mediated proteolysis but also opens new avenues for developing specific inhibitors or activators that could modulate its activity for therapeutic interventions.
