Cat: PA1000-3394

Recombinant Human UBXN2B Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    UBXN2B

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    UBXN2B;UBX domain-containing Protein 2B

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q14CS0

  • Expression Region

    1-331aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMAEGGGPEPGEQERRSSGPRPPSARDL QLALAELYEDEVKCKSSKSNRPKATVFKSPRTPPQRFYSSEHEYSGLNIV RPSTGKIVNELFKEAREHGAVPLNEATRASGDDKSKSFTGGGYRLGSSFC KRSEYIYGENQLQDVQILLKLWSNGFSLDDGELRPYNEPTNAQFLESVKR GEIPLELQRLVHGGQVNLDMEDHQDQEYIKPRLRFKAFSGEGQKLGSLTP EIVSTPSSPEEEDKSILNAVVLIDDSVPTTKIQIRLADGSRLIQRFNSTH RILDVRNFIVQSRPEFAALDFILVTSFPNKELTDESLTLLEADILNTVLL QQLK

  • Molecular Weight

    40 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

UBXN2B is a protein that plays a significant role in various cellular processes, including the regulation of protein degradation and the management of cellular stress responses. It is part of the UBX domain-containing proteins, which are implicated in the ubiquitin-proteasome system (UPS) that controls protein turnover within the cell. Recent studies have highlighted UBXN2B's involvement in modulating autophagy and its potential implications in cancer biology and neurodegenerative diseases. As an accessory factor, UBXN2B can interact with different E3 ubiquitin ligases, thereby influencing the stability and activity of various target proteins. This has prompted research into the therapeutic potential of UBXN2B as a biomarker and target for drug development, especially in conditions where protein homeostasis is disrupted. Investigating the structure, function, and interactions of UBXN2B through recombinant protein studies aids in understanding its specific roles in cellular pathways and may lead to novel insights into disease mechanisms.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US