Analytical Data
-
Gene name
PDE7A
- Application
-
Alternative Names
5''-cyclic phosphodiesterase 7A; HCP 1; HCP1; High affinity cAMP specific 3'5' cyclic phosphodiesterase 7A; High affinity cAMP-specific 3''; P2A; PDE 7; PDE 7A; PDE1/PDE2 yeast human complement of; PDE7; PDE71; PDE7A; PDE7A_HUMAN; Phosphodiesterase 7A; Phosphodiesterase isozyme 7; Phosphodiesterase7A; Rolipram insensitive phosphodiesterase type 7 ; TM 22; TM22
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13946
-
Expression Region
1-456 aa
-
AA Sequence
MEVCYQLPVLPLDRPVPQHVLSRRGAISFSSSSALFGCPNPRQLSQRRGAISYDSSDQTA LYIRMLGDVRVRSRAGFESERRGSHPYIDFRIFHSQSEIEVSVSARNIRRLLSFQRYLRS SRFFRGTAVSNSLNILDDDYNGQAKCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSL HGLIEYFHLDMMKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLANSVTPW DILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESGLFS HLPLESRQQMETQIGALILATDISRQNEYLSLFRSHLDRGDLCLEDTRHRHLVLQMALKC ADICNPCRTWELSKQWSEKVTEEFFHQGDIEKKYHLGVSPLCDRHTESIANIQIGFMTYL VEPLFTEWARFSNTRLSQTMLGHVGLNKASWKGLQREQSSSEDTDAAFELNSQLLPQENRLS
-
Molecular Weight
55.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PDE7A, or phosphodiesterase 7A, is an enzyme that plays a critical role in cellular signaling by hydrolyzing cyclic adenosine monophosphate (cAMP), a key second messenger involved in various physiological processes. Research on PDE7A has gained significance due to its implications in numerous diseases, including neurodegenerative disorders, cardiovascular diseases, and cancer. As a member of the phosphodiesterase family, PDE7A is distinct for its high specificity to cAMP, which makes it a potential therapeutic target. Understanding the structural and functional properties of PDE7A can provide insights into its regulatory mechanisms and interactions with other signaling components. Furthermore, the development of recombinant PDE7A proteins allows for detailed biochemical studies and the identification of small molecule inhibitors that could modulate its activity. Given the rising interest in cAMP signaling pathways in pharmacology, PDE7A presents a promising candidate for drug discovery and development. Consequently, advances in techniques such as protein engineering and crystallography are crucial for elucidating the enzyme's mechanism and for designing PDE7A-based therapies, enhancing our ability to address associated disorders effectively. Overall, the study of PDE7A recombinant proteins not only fosters a deeper understanding of cAMP signaling but also paves the way for innovative treatment strategies targeting various pathological conditions.











