Analytical Data
-
Gene name
ARSH
- Application
-
Alternative Names
ARSH; Arylsulfatase H; ASH
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5FYA8
-
Expression Region
1-562aa
-
AA Sequence
MTRNARPNIVLLMADDLGVGDLCCYGNNSVSTPNIDRLASEGVRLTQHLAAASMCTPSRAAFLTGRYPIRSGMVSAYNLNRAFTWLGGSGGLPTNETTFAKLLQHRGYRTGLIGKWHLGLSCASRNDHCYHPLNHGFHYFYGVPFGLLSDCQASKTPELHRWLRIKLWISTVALALVPFLLLIPKFARWFSVPWKVIFVFALLAFLFFTSWYSSYGFTRRWNCILMRNHEIIQQPMKEEKVASLMLKEALAFIERYKREPFLLFFSFLHVHTPLISKKKFVGRSKYGRYGDNVEEMDWMVGKILDALDQERLANHTLVYFTSDNGGHLEPLDGAVQLGGWNGIYKGGKGMGGWEGGIRVPGIFRWPSVLEAGRVINEPTSLMDIYPTLSYIGGGILSQDRVIDGQNLMPLLEGRASHSDHEFLFHYCGVYLHTVRWHQKDCATVWKAHYVTPKFYPEGTGACYGSGICSCSGDVTYHDPPLLFDISRDPSEALPLNPDNEPLFDSVIKKMEAAIREHRRTLTPVPQQFSVFNTIWKPWLQPCCGTFPFCGCDKEDDILPMAP
-
Molecular Weight
88.77 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ARSH (Arrestin-Related Homolog) recombinant proteins have garnered significant attention in recent years due to their potential roles in various cellular signaling pathways and physiological processes. Arrestins are a family of proteins traditionally known for their involvement in G-protein-coupled receptor (GPCR) desensitization, internalization, and signal termination. ARSH, in particular, is believed to play a crucial role in modulating the activity of GPCRs and other signaling molecules, influencing cellular responses related to inflammation, metabolism, and neurobiology. The study of ARSH recombinant proteins allows researchers to investigate their structure, function, and interactions with other biomolecules in vitro and in vivo. This research is particularly relevant in the context of drug development, as understanding the mechanistic pathways involving ARSH could lead to novel therapeutic approaches for diseases characterized by dysregulated signaling, such as cancer, diabetes, and cardiovascular disorders. Recent advances in recombinant DNA technology have enabled the efficient expression and purification of ARSH proteins, facilitating detailed biochemical and biophysical studies. As such, ARSH recombinant proteins represent a promising avenue for uncovering new insights into cell signaling mechanisms and developing innovative treatments for a range of health conditions.
