Analytical Data
-
Gene name
UBE2S
- Application
-
Alternative Names
UBE2S；E2EPF；Ubiquitin-conjugating enzyme E2 S
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16763
-
Expression Region
1-222aa
-
AA Sequence
MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL
-
Molecular Weight
50.8kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UBE2S, an essential member of the ubiquitin-conjugating enzyme family, plays a significant role in the ubiquitin-proteasome pathway, which is crucial for regulating protein degradation, cell cycle progression, and DNA repair mechanisms. Specifically, UBE2S is known for its involvement in the monoubiquitination and polyubiquitination of target proteins, influencing various cellular processes such as signal transduction and cellular response to stress. Recent studies have suggested that UBE2S may contribute to tumorigenesis by modulating the stability and activity of oncogenic proteins, thereby affecting cancer cell proliferation and survival. Furthermore, UBE2S has been implicated in certain diseases, including neurodegenerative disorders and various types of cancer, highlighting its potential as a therapeutic target. The ability to produce recombinant UBE2S protein offers valuable insights into its molecular functions and interactions. Researchers are keen to explore the structural characteristics and enzymatic activities of UBE2S through recombinant expression systems, enabling further understanding of its role in the ubiquitin signaling pathway. This research could pave the way for developing novel interventions in diseases associated with UBE2S dysregulation, marking its importance in both fundamental biology and clinical applications.
