Analytical Data
-
Gene name
UBE2D1
- Application
-
Alternative Names
UBE2D1；KIAA0010；Ubiquitin-Protein ligase E3C
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P51668
-
Expression Region
1-147aa
-
AA Sequence
MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVF FLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVS KVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UBE2D1, a member of the E2 ubiquitin-conjugating enzyme family, plays a crucial role in the ubiquitin-proteasome pathway, which regulates protein degradation and cellular homeostasis. The enzyme is involved in various cellular processes, including cell cycle regulation, DNA repair, and response to oxidative stress. Dysregulation of UBE2D1 has been implicated in several pathological conditions, including cancer, neurodegenerative diseases, and immune disorders. Recent studies have indicated that UBE2D1 may influence protein stability and signaling pathways by facilitating the ubiquitination of target substrates. The exploration of recombinant UBE2D1 protein has garnered attention due to its potential therapeutic applications and its role as a biomarker for disease progression. By producing UBE2D1 in a controlled laboratory setting, researchers aim to better understand its biochemical properties, substrate interactions, and regulatory mechanisms. This knowledge could pave the way for the development of targeted therapies that modulate UBE2D1 activity, offering new avenues for treating diseases associated with its dysfunction. Overall, the study of recombinant UBE2D1 protein is essential for elucidating its biological functions and therapeutic potential in disease contexts.
