Analytical Data
-
Gene name
ARMCX3
- Application
-
Alternative Names
Armcx3; Alex3; Armadillo repeat-containing X-linked Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8BHS6
-
Expression Region
1-379aa
-
AA Sequence
MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDDTITSRLNSSVQLAGLRLLTNMTVTNEYQHMLANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHMFPKSQE
-
Molecular Weight
68.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ARMCX3, or Armadillo Repeat Containing X-Linked 3, is a gene located on the X chromosome, and it plays a critical role in various cellular processes, including cell adhesion, signaling, and possibly in the development and differentiation of multiple tissues. Recent studies have implicated ARMCX3 in neurodevelopmental disorders, highlighting its potential importance in neuroscience and developmental biology. The protein's structure, characterized by armadillo repeats, suggests it may interact with a range of partners, influencing pathways associated with synaptic functioning and neuronal connectivity. Additionally, given its X-linked nature, variations or mutations in ARMCX3 may contribute to sex-specific susceptibilities in certain diseases, particularly those affecting the nervous system. Researchers are increasingly focused on characterizing ARMCX3 and its protein product to elucidate its biological roles and understand how alterations in its expression or function could lead to pathological conditions. Overall, ARMCX3 represents a promising target for further investigation, which may provide insights into therapeutic strategies for neurodevelopmental and other related disorders.
