Analytical Data
-
Gene name
UBE2B
- Application
-
Alternative Names
UBE2B；RAD6B；Ubiquitin-conjugating enzyme E2 B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P63146
-
Expression Region
1-152aa
-
AA Sequence
MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFED GTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTY DVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWN DS
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UBE2B, a member of the ubiquitin-conjugating enzyme family, plays a crucial role in the ubiquitin-proteasome pathway, a key regulator of protein degradation and cellular homeostasis. This enzyme is involved in the post-translational modification of proteins, whereby ubiquitin molecules are attached to target proteins, marking them for degradation or altering their function. Research has indicated that UBE2B is implicated in various biological processes, including cell cycle regulation, DNA repair, and immune responses, signaling its potential impact on cellular function and disease pathology. Dysregulation of UBE2B has been associated with several conditions, such as cancer and neurodegenerative diseases, making it a significant focus of biomedical research. The study of UBE2B recombinant protein is critical for elucidating its structural and functional properties, enabling the development of therapeutic strategies that can target UBE2B-related pathways. Understanding the mechanistic insights into UBE2B’s interactions with ubiquitin and its substrate proteins can pave the way for novel interventions in diseases linked to proteostasis imbalance. Furthermore, the potential to engineer UBE2B variants could lead to innovative approaches for modulating its activity, offering possibilities for enhancing or inhibiting its function in various therapeutic contexts. As research advances, the characterization of UBE2B recombinant proteins is expected to provide valuable insights that could inspire the development of targeted therapeutics aimed at restoring the normal functions of the ubiquitin-proteasome system in disease states.
