Analytical Data
-
Gene name
ARL10C
- Application
-
Alternative Names
ADP ribosylation factor like 10C; ADP ribosylation factor like 8B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NVJ2
-
Expression Region
18-186aa
-
AA Sequence
KEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS
-
Molecular Weight
21.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ARL10C, a member of the ADP-ribosylation factor-like (ARL) family of small GTPases, has gained attention in recent years due to its potential roles in cellular signaling and developmental processes. GTPases like ARL10C are known to regulate various cellular functions, including vesicle trafficking, cytoskeletal dynamics, and cell differentiation. Research has indicated that ARL10C specifically may be involved in the regulation of neuronal development and synaptic function, suggesting its relevance in neurobiology. Dysregulation of ARL proteins has been implicated in several diseases, including cancer and neurodegenerative disorders, positioning ARL10C as a crucial target for therapeutic interventions. Moreover, advances in recombinant protein technology allow for the production of ARL10C in vitro, facilitating detailed studies of its biochemical properties and interactions with other cellular components. Understanding the function and regulatory mechanisms of ARL10C could provide insights into fundamental biological processes and identify novel strategies for disease treatment.
