Analytical Data
-
Gene name
PCAF
- Application
-
Alternative Names
Histone acetyltransferase KAT2B. EC:2.3.1.48. Histone acetyltransferase PCAF. Histone acetylase PCAF. Lysine acetyltransferase 2B. P300/CBP-associated factor. P/CAF. Spermidine acetyltransferase KAT2B. EC:2.3.1.57
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92831
-
Expression Region
731-832 aa
-
AA Sequence
TLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
-
Molecular Weight
36.96 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PCAF (p300/CBP-associated factor) is a crucial histone acetyltransferase involved in the regulation of gene expression through chromatin remodeling. First identified as a coactivator of nuclear hormone receptors, PCAF plays a significant role in numerous cellular processes, including proliferation, differentiation, and apoptosis. Its dysfunction is linked to various diseases, including cancer and neurodegenerative disorders. Research into PCAF has gained momentum due to its dual function as both a transcriptional coactivator and a regulator of histone acetylation, making it a potential target for therapeutic intervention. The complexity of its interaction with other transcription factors and chromatin remodeling complexes complicates the understanding of its precise mechanisms. Recent studies have focused on the structural characterization of PCAF and the development of small molecules that can modulate its activity. Advanced techniques such as cryo-electron microscopy and X-ray crystallography have provided insights into PCAF’s structure-function relationships, highlighting potential sites for targeted drug design. Furthermore, research emphasizes the need to explore PCAF’s role in different cellular contexts, including stem cell biology and immune response, to fully unravel its biological significance. As therapeutic strategies increasingly incorporate epigenetic modulators, elucidating the role of PCAF and its pathways could pave the way for novel treatments in cancer and other diseases associated with epigenetic dysregulation.
