Analytical Data
-
Gene name
CD147
- Application
-
Alternative Names
CD147；Basigin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35613
-
Expression Region
79 -280aa
-
AA Sequence
VHIHATYHQHAASTISIDTLVEEDTGTYECRASNDPDRNHLTRAPRVKWV RAQAVVLVLEPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVL KEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKS SEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSS SQ
-
Molecular Weight
29 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD147, also known as basigin or extracellular matrix metalloproteinase inducer (EMMPRIN), is a transmembrane glycoprotein that plays a critical role in various physiological and pathological processes, including cell adhesion, migration, and tumor metastasis. Its expression is upregulated in various cancers, making it a significant target for cancer therapy and diagnostics. Research has shown that CD147 interacts with matrix metalloproteinases (MMPs) and promotes their secretion, facilitating extracellular matrix remodeling and tumor invasion. Additionally, CD147 is involved in the immune response and is implicated in conditions such as inflammation, autoimmune diseases, and viral infections, including HIV and COVID-19. The generation of recombinant CD147 proteins has been vital for elucidating its biological functions, molecular mechanisms, and potential therapeutic applications. By producing and characterizing recombinant CD147, researchers aim to better understand its role in disease progression and explore its utility as a biomarker or therapeutic target. The study of CD147 also provides insights into its structure-function relationship and its interactions with other proteins, opening avenues for the development of CD147-targeted therapies that could inhibit tumor growth and improve patient outcomes. Overall, the ongoing research on CD147 recombinant proteins is crucial for advancing our understanding of this multifunctional protein and its implications in health and disease.
