Analytical Data
-
Gene name
OR9Q2
- Application
-
Alternative Names
OR9Q2; OR9Q2P; Olfactory receptor 9Q2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGE9
-
Expression Region
1-314 aa
-
AA Sequence
MAERNYTVVTEFFLTAFTEHLQWRVPLFLIFLSFYLATMLGNTGMILLIRGDRRLHTPMY FFLSHLSLVDICYSSAIIPQMLAVLWEHGTTISQARCAAQFFLFTFFASIDCYLLAIMAY DRYTAVCQPLLYVTIITEKARWGLVTGAYVAGFFSAFVRTVTAFTLSFCGNNEINFIFCD LPPLLKLSCGDSYTQEVVIIVFALFVMPACILVILVSYLFIIVAILQIHSAGGRAKTFST CASHLTAVALFFGTLIFMYLRDNTGQSSEGDRVVSVLYTVVTPMLNPLIYSLRNKEVKEA TRKALSKSKPARRP
-
Molecular Weight
35.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR9Q2 is a member of the olfactory receptor gene family, which plays a crucial role in the perception of odors. Olfactory receptors are G protein-coupled receptors located in the nasal epithelium, and they are responsible for detecting a wide range of odorant molecules, contributing to the complex sense of smell. The study of OR9Q2 is particularly significant due to its potential implications in understanding olfactory function and dysfunction, as well as its involvement in sensory processing. Recent research suggests that variations in olfactory receptor genes, including OR9Q2, may influence individual differences in olfactory perception and may be linked to certain neurological conditions or olfactory disorders. Furthermore, the ability to express OR9Q2 as a recombinant protein enables researchers to investigate its functional properties, ligand specificity, and signaling pathways in a controlled environment. This research background highlights the importance of OR9Q2 in sensory biology and its potential applications in clinical and therapeutic contexts, making it a valuable target for further study in olfactory receptor research.
