Analytical Data
-
Gene name
TIAF1
- Application
-
Alternative Names
TIAF1；TIAF1；Putative TGFB1-induced anti-apoptotic factor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95411
-
Expression Region
1-115aa
-
AA Sequence
MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG
-
Molecular Weight
39.4kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TIAF1 (TIA1-Related Protein 1) is a member of the TIA protein family, which plays a crucial role in regulating various cellular processes, including stress responses and RNA metabolism. The study of TIAF1 has garnered attention due to its implications in both physiological and pathological conditions. Research has indicated that TIAF1 is involved in the regulation of inflammation, apoptosis, and cellular stress responses, making it a potential key player in various diseases, including autoimmune disorders and cancer. The protein's ability to bind to RNA and influence mRNA stability and translation further underscores its significance in gene expression regulation. Elevated levels of TIAF1 have been observed in certain pathological states, suggesting its potential as a biomarker for disease progression. Additionally, the exploration of TIAF1's structural and functional properties through recombinant protein studies can provide insights into its mechanism of action and interaction with other cellular components. Understanding TIAF1 at the molecular level may lead to novel therapeutic strategies targeting its function in disease contexts. The continued investigation into TIAF1's role in cellular dynamics and its relevance to health and disease highlights its importance as a subject of scientific inquiry.
