Cat: PA1000-3200

Recombinant Human TIAF1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TIAF1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TIAF1;TIAF1;Putative TGFB1-induced anti-apoptotic factor 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O95411

  • Expression Region

    1-115aa

  • AA Sequence

    MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG

  • Molecular Weight

    39.4kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TIAF1 (TIA1-Related Protein 1) is a member of the TIA protein family, which plays a crucial role in regulating various cellular processes, including stress responses and RNA metabolism. The study of TIAF1 has garnered attention due to its implications in both physiological and pathological conditions. Research has indicated that TIAF1 is involved in the regulation of inflammation, apoptosis, and cellular stress responses, making it a potential key player in various diseases, including autoimmune disorders and cancer. The protein's ability to bind to RNA and influence mRNA stability and translation further underscores its significance in gene expression regulation. Elevated levels of TIAF1 have been observed in certain pathological states, suggesting its potential as a biomarker for disease progression. Additionally, the exploration of TIAF1's structural and functional properties through recombinant protein studies can provide insights into its mechanism of action and interaction with other cellular components. Understanding TIAF1 at the molecular level may lead to novel therapeutic strategies targeting its function in disease contexts. The continued investigation into TIAF1's role in cellular dynamics and its relevance to health and disease highlights its importance as a subject of scientific inquiry.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US