Analytical Data
-
Gene name
OR9K2
- Application
-
Alternative Names
OR9K2; Olfactory receptor 9K2; Olfactory receptor OR12-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGE7
-
Expression Region
1-335 aa
-
AA Sequence
MLGSKPRVHLYILPCASQQVSTMGDRGTSNHSEMTDFILAGFRVRPELHILLFLLFLFVY AMILLGNVGMMTIIMTDPRLNTPMYFFLGNLSFIDLFYSSVIEPKAMINFWSENKSISFA GCVAQLFLFALLIVTEGFLLAAMAYDRFIAICNPLLYSVQMSTRLCTQLVAGSYFCGCIS SVIQTSMTFTLSFCASRAVDHFYCDSRPLQRLSCSDLFIHRMISFSLSCIIILPTIIVII VSYMYIVSTVLKIHSTEGHKKAFSTCSSHLGVVSVLYGAVFFMYLTPDRFPELSKVASLC YSLVTPMLNPLIYSLRNKDVQEALKKFLEKKNIIL
-
Molecular Weight
37.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR9K2 is a member of the olfactory receptor family, which plays a pivotal role in the sensory perception of odorants and is involved in various biological processes. Despite the extensive research surrounding olfactory receptors, the functional characteristics and physiological roles of OR9K2 remain largely unexplored. Recent studies have highlighted the potential implications of OR9K2 in neuronal signaling and its possible association with specific neurological conditions. The interest in OR9K2 has surged due to its unique expression patterns in the brain, suggesting that it may be involved in modulating olfactory processing and influencing neural circuit functions. Understanding the structure and function of OR9K2, through approaches such as recombinant protein expression and purification, is crucial for elucidating its role in the central nervous system. Characterizing this protein could provide insights into its mechanisms of action and its potential as a therapeutic target for olfactory-related disorders. Additionally, the study of OR9K2 holds promise for advancing our knowledge of the broader olfactory receptor family and its implications in sensory biology, ultimately contributing to a more comprehensive understanding of how organisms interact with their environment through olfaction.
