Analytical Data
-
Gene name
CYP2C19
- Application
-
Alternative Names
CYP2C19；Cytochrome P450 2C19
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P33261
-
Expression Region
26-490aa
-
AA Sequence
RGKLPPGPTPLPVIGNILQIDIKDVSKSLTNLSKIYGPVFTLYFGLERMVVLHGYEVVKEALIDLGEEFSGRGHFPLAERANRGFGIVFSNGKRWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICSIIFQKRFDYKDQQFLNLMEKLNENIRIVSTPWIQICNNFPTIIDYFPGTHNKLLKNLAFMESDILEKVKEHQESMDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTETTSTTLRYALLLLLKHPEVTAKVQEEIERVVGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCDVKFRNYLIPKGTTILTSLTSVLHDNKEFPNPEMFDPRHFLDEGGNFKKSNYFMPFSAGKRICVGEGLARMELFLFLTFILQNFNLKSLIDPKDLDTTPVVNGFASVPPFYQLCFIPV
-
Molecular Weight
60.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CYP2C19 (Cytochrome P450 2C19) is a crucial enzyme involved in the metabolism of various drugs, including antiplatelet agents, antidepressants, and proton pump inhibitors. Genetic polymorphisms in the CYP2C19 gene lead to significant inter-individual variability in drug metabolism, categorizing individuals as poor, intermediate, extensive, or ultrarapid metabolizers. This variability can impact therapeutic efficacy and safety, making it essential to understand the enzyme's structure and function. Research on recombinant CYP2C19 proteins has become a key focus to elucidate the mechanisms underlying drug metabolism and to develop personalized medicine approaches. By producing and studying recombinant CYP2C19, researchers aim to gain insights into substrate specificity, inhibitor interactions, and the effects of genetic variations on enzymatic activity. Such studies can inform drug development, optimize dosing strategies, and improve patient outcomes by tailoring treatments based on individual metabolic profiles. Furthermore, the recombinant proteins serve as valuable tools in pharmacological studies, enabling the screening of new compounds and the investigation of metabolic pathways associated with CYP2C19. As the field advances, understanding CYP2C19's role in drug metabolism is crucial for enhancing therapeutic interventions and minimizing adverse drug reactions in diverse populations.
