Analytical Data
-
Gene name
OR7D2
- Application
-
Alternative Names
OR7D2; Olfactory receptor 7D2; HTPCRH03; Olfactory receptor 19-4; OR19-4; Olfactory receptor OR19-10
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96RA2
-
Expression Region
1-312 aa
-
AA Sequence
MEAGNQTGFLEFILLGLSEDPELQPFIFGLFLSMYLVTVLGNLLIILAISSDSHLHTPMY FFLSNLSWVDICFSTCIVPKMLVNIQTENKAISYMDCLTQVYFSMFFPILDTLLLTVMAY DRFVAVCHPLHYMIIMNPHLCGLLVFVTWLIGVMTSLLHISLMMHLIFCKDFEIPHFFCE LTYILQLACSDTFLNSTLIYFMTGVLGVFPLLGIIFSYSRIASSIRKMSSSGGKQKALST CGSHLSVVSLFYGTGIGVHFTSAVTHSSQKISVASVMYTVVTPMLNPFIYSLRNKDVKGA LGSLLSRAASCL
-
Molecular Weight
34.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR7D2, a member of the olfactory receptor family, is predominantly expressed in the olfactory epithelium and plays a crucial role in the detection of odorants. Research has shown that OR7D2 is involved in the recognition of certain pheromones and other volatile compounds, influencing social and reproductive behaviors in various species. Given its significance in olfactory signaling pathways, the study of OR7D2 reconstituted as a recombinant protein has garnered attention in the fields of neuroscience and biotechnology. The ability to generate OR7D2 as a recombinant protein allows for detailed structural and functional studies, facilitating the understanding of its interactions with odorant molecules and the downstream signaling mechanisms. This research may lead to the development of novel applications in synthetic biology, sensory biology, and even therapeutic strategies for olfactory dysfunction. Moreover, investigating the polymorphisms in the OR7D2 gene across different populations can provide insights into the evolutionary adaptation of olfactory sensitivity and variability in odor perception. Overall, the recombinant OR7D2 protein serves as a vital tool in elucidating the intricate mechanisms of olfaction and its broader implications in animal behavior and interactions.
