Analytical Data
-
Gene name
ETM
- Application
-
Alternative Names
ETM；Glucokinase
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P11039
-
Expression Region
1-113aa
-
AA Sequence
MDALHGICVNINKFYKCRRIVIEYDNCSASFTFNCVHDNRKVNCLEIVGLRRNEYVCLGKIINGDKIISVHENSVNGKIIVPVEDTFDFGLFTLKNKITDAVIKLNVYINETS
-
Molecular Weight
12.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ETM (Enhancer of Ty1 Mediator) proteins are pivotal in the realm of molecular biology, particularly in the context of gene regulation and transcriptional control. Recent studies have highlighted their crucial role in the modulation of transcriptional enhancers and their interaction with various chromatin components. Emerging research suggests that ETM proteins facilitate the assembly of multi-protein complexes that are essential for the initiation and elongation phases of transcription. This regulation is critical for maintaining cellular homeostasis and responding to environmental stimuli. aberrations in ETM protein function can lead to misregulation of gene expression, contributing to various diseases, including cancer. The ongoing investigation into the structure and function of ETM proteins aims to elucidate their mechanisms of action and potential as therapeutic targets. Advances in techniques, such as CRISPR and high-throughput sequencing, have propelled the field forward, allowing researchers to explore the dynamic interplay between ETM proteins and gene expression in greater detail. Understanding ETM protein dynamics not only provides insights into fundamental biological processes but also opens avenues for innovative strategies in gene therapy and disease treatment.
