Analytical Data
-
Gene name
TGFBR2
- Application
-
Alternative Names
TGFBR2；ALK5；TGF-beta receptor type-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P37173
-
Expression Region
23-166aa
-
AA Sequence
TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQ
-
Molecular Weight
23.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Transforming Growth Factor Beta Receptor II (TGFBR2) is a key component of the TGF-β signaling pathway, which plays an essential role in regulating various cellular processes, including cell proliferation, differentiation, apoptosis, and immune response. Abnormalities in this pathway have been implicated in a range of diseases, including cancer, fibrosis, and hereditary syndromes such as Marfan and Loeys-Dietz syndromes. Research into TGFBR2 has intensified due to its potential as a therapeutic target; however, the lack of available recombinant protein has hindered functional studies. Recombinant TGFBR2 protein production allows scientists to better understand its structure, function, and interactions with ligands and other proteins, facilitating the development of targeted therapies. By elucidating TGFBR2's role in disease mechanisms, researchers aim to identify novel biomarkers for diagnosis and prognosis, as well as to create strategies for intervention that mitigate the adverse effects of TGF-β signaling dysregulation. Hence, the production and characterization of TGFBR2 recombinant protein is essential for advancing our knowledge in molecular biology and pharmacology, ultimately contributing to improved health outcomes.
