Analytical Data
-
Gene name
TGFBRAP1
- Application
-
Alternative Names
TGFBRAP1；Transforming growth factor-beta receptor-associated Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WUH2
-
Expression Region
601-860aa
-
AA Sequence
RGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSKRLQKEEYHTHLAVL YLEEVLLQRASASGKGAEATETQAKLRRLLQKSDLYRVHFLLERLQGAGL PMESAILHGKLGEHEKALHILVHELQDFAAAEDYCLWCSEGRDPPHRQQL FHTLLAIYLHAGPTAHELAVAAVDLLNRHATEFDAAQVLQMLPDTWSVQL LCPFLMGAMRDSIHARRTMQVALGLARSENLIYTYDKMKLKGSSIQLSDK KLCQICQNPFCEPVFVRYPNGGLVHTHCAASRHTNPSSSSPGTRT
-
Molecular Weight
33 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TGFBRAP1, or TGF-beta receptor-associated protein 1, is a crucial protein that plays a significant role in the signaling pathways mediated by Transforming Growth Factor-beta (TGF-β). This protein has garnered attention in recent years due to its involvement in various cellular processes, including epithelial-to-mesenchymal transition (EMT), cell differentiation, and the regulation of immune responses. Dysregulation of TGFBRAP1 has been implicated in several pathological conditions, including fibrosis and cancer, where it may contribute to tumor progression and metastasis. Research focusing on the recombinant expression of TGFBRAP1 has become increasingly important as it allows for the investigation of its structure-function relationships and interactions with other proteins involved in TGF-β signaling. Recombined TGFBRAP1 can be used in various in vitro and in vivo studies to elucidate its biological functions, validate its role as a potential therapeutic target, and explore its interactions within the broader context of TGF-β signaling networks. This understanding could lead to innovative approaches for targeted therapies in diseases where TGFBRAP1 plays a crucial role, making it a significant focus within the fields of molecular biology and translational medicine.
