Cat: PA1000-3171

Recombinant Human TFF1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TFF1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TFF1;BCEI;Trefoil factor 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P04155

  • Expression Region

    25-84aa

  • AA Sequence

    EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF

  • Molecular Weight

    33.7kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TFF1, or Trefoil Factor 1, is a peptide that plays a critical role in mucosal healing and protection, primarily in the gastrointestinal tract. Research into TFF1 has increased due to its significant involvement in various physiological processes, including cell proliferation, migration, and the maintenance of mucosal barrier integrity. Originally identified in gastric mucosa, TFF1 is known for its ability to promote epithelial cell survival and repair, making it a key player in response to injuries such as ulcers and inflammation. Moreover, TFF1 has garnered attention for its potential associations with certain diseases, particularly gastric cancer, where its expression levels may serve as a biomarker for disease progression. The therapeutic implications of TFF1 have also sparked interest, as enhancing its expression or mimicking its function could offer novel strategies for treating gastrointestinal disorders and improving mucosal healing. Current studies focus on elucidating the molecular mechanisms underlying TFF1's protective effects and exploring its applications in regenerative medicine and cancer therapeutics. By advancing our understanding of TFF1, researchers aim to unlock new avenues for medical interventions aimed at enhancing mucosal health and treating associated diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US