Analytical Data
-
Gene name
TFF1
- Application
-
Alternative Names
TFF1;BCEI;Trefoil factor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P04155
-
Expression Region
25-84aa
-
AA Sequence
EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
-
Molecular Weight
33.7kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TFF1, or Trefoil Factor 1, is a peptide that plays a critical role in mucosal healing and protection, primarily in the gastrointestinal tract. Research into TFF1 has increased due to its significant involvement in various physiological processes, including cell proliferation, migration, and the maintenance of mucosal barrier integrity. Originally identified in gastric mucosa, TFF1 is known for its ability to promote epithelial cell survival and repair, making it a key player in response to injuries such as ulcers and inflammation. Moreover, TFF1 has garnered attention for its potential associations with certain diseases, particularly gastric cancer, where its expression levels may serve as a biomarker for disease progression. The therapeutic implications of TFF1 have also sparked interest, as enhancing its expression or mimicking its function could offer novel strategies for treating gastrointestinal disorders and improving mucosal healing. Current studies focus on elucidating the molecular mechanisms underlying TFF1's protective effects and exploring its applications in regenerative medicine and cancer therapeutics. By advancing our understanding of TFF1, researchers aim to unlock new avenues for medical interventions aimed at enhancing mucosal health and treating associated diseases.











