Cat: PAX2000-10009

Recombinant Human OR6N2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    OR6N2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    OR6N2; Olfactory receptor 6N2; Olfactory receptor OR1-23

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8NGY6

  • Expression Region

    1-317 aa

  • AA Sequence

    MDQYNHSSLAEFVFLGFASVGYVRGWLFVLLLLAYLFTICGNMLIFSVIRLDAALHTPMY HFVSVLSFLELWYTATTIPKMLSNILSEKKTISFAGCLLQTYFFHSLGASECYLLTAMAY DRYLAICRPLHYPIIMTTTLCAKMAAACWTCGFLCPISEVILASQLPFCAYNEIQHIFCD FPPLLSLACKDTSANILVDFAINAFIILITFFFIMISYARIIGAVLKIKTASGRKKAFST CASHLAVVLIFFGSIIFMYVRLKKSYSLTLDRTLAIVYSVLTPMVNPIIYSLRNKEIIKA IKRTIFQKGDKASLAHL

  • Molecular Weight

    35.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

OR6N2 is a member of the olfactory receptor gene family, specifically belonging to the class of G protein-coupled receptors (GPCRs). These receptors play a crucial role in the sensory perception of odors, impacting various biological processes and behaviors. Although most olfactory receptors are primarily expressed in the nasal epithelium and are integral to the sense of smell, OR6N2 has gained attention for its potential involvement in non-olfactory functions, such as those related to the central nervous system and other physiological processes. Research has shown that olfactory receptors can be expressed in various tissues beyond the nose, suggesting a broader biological significance. This has led to investigations into the functional properties and signaling pathways associated with OR6N2, with the aim of elucidating its role in human health and disease. The recombinant expression of OR6N2 protein is essential for functional studies, allowing researchers to explore its ligand binding, signal transduction mechanisms, and potential therapeutic targets. Current studies focus on determining the natural ligands for OR6N2 as well as its interactions with cellular components, which may contribute to advancements in understanding sensory biology and developing novel pharmacological strategies. Understanding the intricacies of OR6N2 and its functionality may provide insights into olfactory signal processing and its implications in various neurological disorders. Overall, the research surrounding OR6N2 is not only pivotal for uncovering the complexities of olfactory biology but also holds promise for advancing biomedical science and improving therapeutic interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US