Analytical Data
-
Gene name
OR6N2
- Application
-
Alternative Names
OR6N2; Olfactory receptor 6N2; Olfactory receptor OR1-23
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGY6
-
Expression Region
1-317 aa
-
AA Sequence
MDQYNHSSLAEFVFLGFASVGYVRGWLFVLLLLAYLFTICGNMLIFSVIRLDAALHTPMY HFVSVLSFLELWYTATTIPKMLSNILSEKKTISFAGCLLQTYFFHSLGASECYLLTAMAY DRYLAICRPLHYPIIMTTTLCAKMAAACWTCGFLCPISEVILASQLPFCAYNEIQHIFCD FPPLLSLACKDTSANILVDFAINAFIILITFFFIMISYARIIGAVLKIKTASGRKKAFST CASHLAVVLIFFGSIIFMYVRLKKSYSLTLDRTLAIVYSVLTPMVNPIIYSLRNKEIIKA IKRTIFQKGDKASLAHL
-
Molecular Weight
35.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR6N2 is a member of the olfactory receptor gene family, specifically belonging to the class of G protein-coupled receptors (GPCRs). These receptors play a crucial role in the sensory perception of odors, impacting various biological processes and behaviors. Although most olfactory receptors are primarily expressed in the nasal epithelium and are integral to the sense of smell, OR6N2 has gained attention for its potential involvement in non-olfactory functions, such as those related to the central nervous system and other physiological processes. Research has shown that olfactory receptors can be expressed in various tissues beyond the nose, suggesting a broader biological significance. This has led to investigations into the functional properties and signaling pathways associated with OR6N2, with the aim of elucidating its role in human health and disease. The recombinant expression of OR6N2 protein is essential for functional studies, allowing researchers to explore its ligand binding, signal transduction mechanisms, and potential therapeutic targets. Current studies focus on determining the natural ligands for OR6N2 as well as its interactions with cellular components, which may contribute to advancements in understanding sensory biology and developing novel pharmacological strategies. Understanding the intricacies of OR6N2 and its functionality may provide insights into olfactory signal processing and its implications in various neurological disorders. Overall, the research surrounding OR6N2 is not only pivotal for uncovering the complexities of olfactory biology but also holds promise for advancing biomedical science and improving therapeutic interventions.











