Analytical Data
-
Gene name
TSPAN25
- Application
-
Alternative Names
TSPAN25；MOX44；TSPAN25；Leukocyte surface antigen CD53
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P19397
-
Expression Region
1-219aa
-
AA Sequence
MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVGSIIMVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSNFLYIGIITICVCVIEVLGMSFALTLNCQIDKTSQTIGL
-
Molecular Weight
24.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TSPAN25, a member of the tetraspanin family of proteins, plays a significant role in various cellular processes, including cell adhesion, signaling, and the formation of membrane microdomains known as tetraspanin web. Research on TSPAN25 has gained traction due to its potential involvement in cancer progression and immune response modulation. Studies have shown that TSPAN25 can influence the behavior of immune cells and may affect tumor microenvironment interactions. Its expression levels have been correlated with various cancers, suggesting a role in tumor biology. The recombinant protein of TSPAN25 is utilized in investigations to clarify its functional roles and mechanisms at the molecular level. By studying TSPAN25 in a recombinant form, researchers can better understand its structure-function relationships and interactions with other membrane proteins. This research has implications for therapeutic strategies, as targeting TSPAN25 might influence immunological processes or alter tumor progression, highlighting its potential as a biomarker or therapeutic target in cancer treatments. Exploring TSPAN25's functionalities and interactions through recombinant techniques can pave the way for novel approaches in cancer therapy and precision medicine.
