Cat: PA1000-3165

Recombinant Human TDP2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TDP2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TDP2;EAP2;;Tyrosyl-DNA phosphodiesterase 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O95551

  • Expression Region

    1-362aa

  • AA Sequence

    MELGSCLEGGREAAEEEGEPEVKKRRLLCVEFASVASCDAAVAQCFLAEN DWEMERALNSYFEPPVEESALERRPETISEPKTYVDLTNEETTDSTTSKI SPSEDTQQENGSMFSLITWNIDGLDLNNLSERARGVCSYLALYSPDVIFL QEVIPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFP STKMMRNLLCVHVNVSGNELCLMTSHLESTRGHAAERMNQLKMVLKKMQE APESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQ MNSNLGITAACKLRFDRIFFRAAAEEGHIIPRSLDLLGLEKLDCGRFPSD HWGLLCNLDIIL

  • Molecular Weight

    67 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TDP2 (tyrosyl-DNA phosphodiesterase 2) is a crucial enzyme involved in the repair of DNA double-strand breaks caused by topoisomerase II (Top2) activity. The mechanism by which Top2 creates transient breaks in DNA is vital for processes such as DNA replication and transcription; however, when these breaks fail to complete correctly, they can lead to genomic instability, contributing to various diseases, including cancer. TDP2 specifically recognizes and resolves the toxic adducts formed when topoisomerase II covalently binds to the ends of DNA breaks. Dysfunction in TDP2 has been linked to therapeutic resistance in cancers treated with topoisomerase inhibitors, making it an essential target for cancer research. Understanding TDP2's structure and function could provide insights into developing novel therapeutic strategies to enhance the effectiveness of existing chemotherapy regimens. Recent advancements in structural biology techniques, including X-ray crystallography and cryo-electron microscopy, have enabled researchers to elucidate the detailed molecular mechanisms of TDP2 activity, paving the way for targeted drug design. As such, TDP2 not only plays a significant role in maintaining genomic integrity but also represents a potential biomarker and therapeutic target in oncology, highlighting the importance of ongoing research in this area.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US