Cat: PA1000-3166

Recombinant Human TEF Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TEF

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TEF;KIAA1655;Thyrotroph embryonic factor

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q10587

  • Expression Region

    1-303aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMSDAGGGKKPPVDPQAGPGPGPGRAAG ERGLSGSFPLVLKKLMENPPREARLDKEKGKEKLEEDEAAAASTMAVSAS LMPPIWDKTIPYDGESFHLEYMDLDEFLLENGIPASPTHLAHNLLLPVAE LEGKESASSSTASPPSSSTAIFQPSETVSSTESSLEKERETPSPIDPNCV EVDVNFNPDPADLVLSSVPGGELFNPRKHKFAEEDLKPQPMIKKAKKVFV PDEQKDEKYWTRRKKNNVAAKRSRDARRLKENQITIRAAFLEKENTALRT EVAELRKEVGKCKTIVSKYETKYGPL

  • Molecular Weight

    36 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The research on TEF (Transcription Enhancer Factor) recombinant proteins stems from the critical role these proteins play in regulating gene expression and cellular processes. TEFs are transcription factors that interact with specific DNA sequences, influencing the transcription of target genes involved in various biological functions, including development, differentiation, and response to environmental stimuli. Investigating TEF recombinant proteins helps in understanding their structural and functional characteristics, as well as their interactions with other cellular components. This knowledge is essential for elucidating the molecular mechanisms underlying diseases, such as cancer, where aberrant gene expression patterns are prevalent. Additionally, TEF proteins can serve as potential targets for therapeutic intervention, making their study valuable for drug discovery efforts. By producing recombinant forms of TEF proteins in model systems, researchers can study their functional properties in detail, assess their potential as biomarkers, and explore their utility in biotechnology applications, such as gene therapy and synthetic biology. Overall, the exploration of TEF recombinant proteins is a promising avenue for advancing our understanding of gene regulation and developing novel therapeutic strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US