Analytical Data
-
Gene name
SCB
- Application
-
Alternative Names
SCB；Succinate--CoA ligase [GDP-forming] subunit beta. mitochondrial
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96I99
-
Expression Region
1-432aa
-
AA Sequence
MASPVAAQAGKLLRALALRPRFLAAGSQAVQLTSRRWLNLQEYQSKKLMSDNGVRVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFNSGLKGGVHLTKDPNVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIFEGIKDSQAQRMAENLGFVGPLKSQAADQITKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKEAQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVQEAQKILNNSGLPITSAIDLEDAAKKAVASVAKK
-
Molecular Weight
46.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research into SCB (Stringent Control of biosynthesis) recombinant proteins is driven by the increasing demand for efficient production of high-quality proteins for biomedical and industrial applications. Recombinant proteins, produced through recombinant DNA technology, enable the synthesis of proteins that are otherwise difficult to purify or yield in sufficient quantities from natural sources. The SCB system, known for its stringent regulation mechanisms, serves as a valuable tool for optimizing protein expression in various host organisms, particularly in bacterial systems like Escherichia coli. By manipulating the SCB system, researchers aim to enhance the yield, solubility, and activity of recombinant proteins, which are crucial for developing therapeutics, vaccines, and diagnostic tools. Furthermore, the SCB platform is pivotal for the production of enzymes and other biocatalysts that are essential in industrial processes. As the need for sustainable and efficient bioproduction methods grows, understanding and improving the SCB system could lead to significant advancements in both the biotechnology field and related disciplines, fostering innovations that could impact healthcare, agriculture, and beyond. The exploration of SCB recombinant proteins thus stands as a fundamental area of research with the potential to address challenges in protein engineering, production scalability, and functional characterization.
